Environmental chemistry.

Environmental chemistry of arsenic / by: (Language materials, printed)

Principles of chemical separations with environmental applications / by: (Language materials, printed)

Organometallic compounds in the environment / by: (Electronic resources)

Environmental sampling and analysis for metals / by: (Language materials, printed)

Persistence and spatial range of environmental chemicals new ethical and scientific concepts for risk assessment / by: (Electronic resources)

Chemical degradation methods for wastes and pollutants :environmental and industrial applications / by: (Language materials, printed)

Environmental catalysis / by: (Language materials, printed)

Handbook of property estimation methods for environmental chemicals :environmental and health sciences / by: (Language materials, printed)

Environmental chemistry / by: (Language materials, printed)

Basic concepts of environmental chemistry / by: (Language materials, printed)

Environmental chemical analysis / by: (Language materials, printed)

Elements of environmental chemistry / by: (Electronic resources)

Atmospheric degradation of organic substances :data for persistence and long-range transport potential / by: (Electronic resources)

Chromatographic analysis of the environment / by: (Language materials, printed)

Environmental chemistry by: (Electronic resources)

Trace environmental quantitative analysisprinciples, techniques, and applications / by: (Electronic resources)

Introduction to chemical transport in the environment by: (Electronic resources)

Contaminated sediments by: (Electronic resources)

Environmental consequences of war and aftermath by: (Electronic resources)

Oil spill environmental forensicsfingerprinting and source identification / by: (Electronic resources)

Intercontinental transport of air pollution by: (Electronic resources)

Transformation products of synthetic chemicals in the environment by: (Electronic resources)

Environmental chemistry / by: (Language materials, printed)

Chemistry of the environment by: (Electronic resources)

Electrochemistry for the environment by: (Electronic resources)

Reactive halogen compounds in the atmosphere by: (Electronic resources)

Bioaccumulationnew aspects and developments / by: (Electronic resources)

Anthropogenic Compounds by: (Electronic resources)

Biodegradation and persistence by: (Electronic resources)

Pollutant-solid phase interactionsmechanisms, chemistry and modeling / by: (Electronic resources)

Anthropogenic compounds by: (Electronic resources)

Basic concepts of environmental chemistry by: (Electronic resources)

Fundamentals of environmental chemistry / by: (Language materials, printed)

Handbook of chemical mass transport in the environment / by: (Language materials, printed)

Arsenic :environmental chemistry, health threats, and waste treatment / by: (Language materials, printed)

Environmental surfaces and interfaces from the nanoscale to the global scale / by: (Language materials, printed)

Brominated flame retardants by: (Electronic resources)

Environmental chemistrymicroscale laboratory experiments / by: (Electronic resources)

Green approaches to asymmetric catalytic synthesis by: (Electronic resources)

Polyfluorinated chemicals and transformation products by: (Electronic resources)

Environmental chemistry for a sustainable world.Volume 1,Nanotechnology and health risk by: (Electronic resources)

Environmental chemistry for a sustainable world.Volume 2,Remediation of air and water pollution by: (Electronic resources)

Sustainability in the chemical industry by: (Electronic resources)

Chemistry in context :applying chemistry to society / by: (Language materials, printed)

Immunoassay and other bioanalytical techniques / by: (Language materials, printed)

Capture and utilization of carbon dioxide with polyethylene glycol by: (Electronic resources)

Key concepts in environmental chemistry by: (Electronic resources)

Chemistry of the upper and lower atmospheretheory, experiments, and applications / by: (Electronic resources)

Biophysical chemistry of fractal structures and processes in environmental systems by: (Electronic resources)

Biophysico-chemical processes involving natural nonliving organic matter in environmental systems by: (Electronic resources)

Inorganic chemistryan industrial and environmental perspective / by: (Electronic resources)

Adsorption, ion exchange and catalysisdesign of operations and environmental applications / by: (Electronic resources)

Applications of environmental aquatic chemistrya practical guide / by: (Electronic resources)

Oil pollution in the baltic sea by: (Electronic resources)

Applied manure and nutrient chemistry for sustainable agriculture and environment by: (Electronic resources)

Green chemistrySynthesis of Bioactive Heterocycles / by: (Electronic resources)

Environmental chemistrynew techniques and data / by: (Electronic resources)

High pressure fluid technology for green food processing by: (Electronic resources)

The sava river by: (Electronic resources)

Environment, energy and climate changeI,Environmental chemistry of pollutants and wastes by: (Electronic resources)

Advances in watershed science and assessment by: (Electronic resources)

Handbook of chemical mass transport in the environment by: (Electronic resources)

Redox biocatalysisfundamentals and applications / by: (Electronic resources)

Ecological biochemistryenvironmental and interspecies interactions / by: (Electronic resources)

Transformation products of emerging contaminants in the environmentanalysis, processes, occurrence, effects and risks / by: (Electronic resources)

Verhalten und abbau von umweltchemikalienphysikalich-chemische grundlagen / by: (Electronic resources)

Environmental photochemistry.Part III by: (Electronic resources)

Pollutants in buildings, water and living organisms by: (Electronic resources)

Personal care products in the aquatic environment by: (Electronic resources)

Radionuclides in the environmentinfluence of chemical speciation and plant uptake on radionuclide migration / by: (Electronic resources)

Chemistry of advanced environmental purification processes of water :fundamentals and applications / by: (Language materials, printed)

Photocatalytic activity enhancement of titanium dioxide nanoparticlesdegradation of pollutants in wastewater / by: (Electronic resources)

Environment, energy and climate change.II,Energies from new resources and the climate change by: (Electronic resources)

Dynamics of the Pantanal Wetland in South America by: (Electronic resources)

Oil pollution in the North Sea by: (Electronic resources)

Threats to the quality of groundwater resourcesprevention and control / by: (Electronic resources)

Emerging contaminants in river ecosystemsoccurrence and effects under multiple stress conditions / by: (Electronic resources)

Chemistry of advanced environmental purification processes of waterfundamentals and applications / by: (Electronic resources)

Electro-fenton processnew trends and scale-up / by: (Electronic resources)

The role of halogens in terrestrial and extraterrestrial geochemical processessurface, crust, and mantle / by: (Electronic resources)

Chemistry of sustainable energy by: (Electronic resources)

Advanced green chemistry.Part 1,Greener organic reactions and processes by: (Electronic resources)

Cyclodextrin fundamentals, reactivity and analysis by: (Electronic resources)

Cyclodextrin applications in medicine, food, environment and liquid crystals by: (Electronic resources)

Green adsorbents for pollutant removalfundamentals and design / by: (Electronic resources)

Green adsorbents for pollutant removalinnovative materials / by: (Electronic resources)

Environmental organic chemistry for engineers / by: (Electronic resources)

Environmental inorganic chemistry for engineers / by: (Electronic resources)

Sustainable agriculture reviews.Chitin and chitosan: applications in food, agriculture, pharmacy, medicine and wastewater treatment36 : by: (Electronic resources)

Sustainable agriculture reviews.Chitin and chitosan: history, fundamentals and innovations35 : by: (Electronic resources)

Fate and effects of anticancer drugs in the environment by: (Electronic resources)

Modeling the fate of chemicals in products by: (Electronic resources)

A new paradigm for environmental chemistry and toxicologyfrom concepts to insights / by: (Electronic resources)

Polish river basins and lakes.Part II,Biological status and water management by: (Electronic resources)

Antibiotic resistance in the environmenta worldwide overview / by: (Electronic resources)

Microbial strategies for techno-economic biofuel production by: (Electronic resources)

Plant responses to soil pollution by: (Electronic resources)

Phytoremediation of arsenic contaminated sites in Chinatheory and practice / by: (Electronic resources)

Water resources in Algeria.Part I,Assessment of surface and groundwater resources by: (Electronic resources)

Non-steroidal anti-inflammatory drugs in wateremerging contaminants and ecological impact / by: (Electronic resources)

Bioavailability of organic chemicals in soil and sediment by: (Electronic resources)

New developments in adsorption/separation of small molecules by zeolites by: (Electronic resources)

Alternative energy resourcesthe way to a sustainable modern society / by: (Electronic resources)

Spatial modeling and assessment of environmental contaminantsrisk assessment and remediation / by: (Electronic resources)

Environmental and natural resources engineering by: (Electronic resources)

Integrated natural resources management by: (Electronic resources)

Trends of environmental forensics in Pakistan by: (Electronic resources)

Nanomaterials and nanocomposites for environmental remediation by: (Electronic resources)

The secret life of chemicals by: (Electronic resources)

Oxygen isotopes of inorganic phosphate in environmental samplespurification and analysis / by: (Electronic resources)

Medicinal and environmental chemistryexperimental advances and simulations.Part II / by: (Electronic resources)

Medicinal and environmental chemistryexperimental advances and simulations.Part I / by: (Electronic resources)

Mass spectrometry in food and environmental chemistry by: (Electronic resources)

Extraction techniques for environmental analysis by: (Electronic resources)

Fragrances in the environment by: (Electronic resources)

Water crises and sustainable management in the Global South by: (Electronic resources)

Sustainable development goals towards environmental toxicity and green chemistryenvironment and sustainability / by: (Electronic resources)

Environmental chemistryadvanced concepts and applications / by: (Electronic resources)